PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462939086
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 202aa    MW: 23144 Da    PI: 8.1987
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462939086genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+  ++ +G gtW+++a+  g+++++k+c++rw +yl
        462939086 18 KGLWSPDEDERLYSHIRNYGVGTWSSVAELAGLKKSGKSCRLRWMNYL 65
                     678*****************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.6471369IPR017930Myb domain
SuperFamilySSF466899.94E-2316106IPR009057Homeodomain-like
SMARTSM007172.0E-121767IPR001005SANT/Myb domain
PfamPF002494.8E-151865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-191972IPR009057Homeodomain-like
CDDcd001676.91E-102165No hitNo description
PROSITE profilePS512948.81270114IPR017930Myb domain
SMARTSM007170.01370112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1273114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MASEEKEGAK PCVTKKRKGL WSPDEDERLY SHIRNYGVGT WSSVAELAGL KKSGKSCRLR  60
WMNYLRPDLR MEPISKQEED LIISLQKVLG NTRMPGRTDN EIKNYWNSRI KKKLRRTCAD  120
RYQSPETRQT AEKSAPFNTE DGNLDVTSSH NNSANEKPHS HFPIFACQLL TGEQNCEQAA  180
PYSSLSKNNE VDLLVEDYVD FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-20181147108B-MYB
1h8a_C1e-191811427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108114RIKKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448905.15e-62hypothetical protein SORBIDRAFT_05g001215, partial
SwissprotP200276e-44MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5Y3I16e-62C5Y3I1_SORBI; Putative uncharacterized protein Sb05g001215 (Fragment)
STRINGSb05g001215.12e-61(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.19e-45myb domain protein 61